PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_1DL_AEBCCB52B.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family VOZ
Protein Properties Length: 428aa    MW: 47285.2 Da    PI: 5.2613
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_1DL_AEBCCB52B.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ411.71.3e-126953121217
                    VOZ   1 pppsaflgpkcalwdctrpaqgsewlqdycssfhatlalne.glpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatak 87 
                            p+ps++lgpkcalwdc rp++gse++qdyc+ +ha lal + gl+gt+pv+rp+gidlkdg+lf+al akvqgk+vgip+cegaat+k
  Traes_1DL_AEBCCB52B.1  95 PSPSQYLGPKCALWDCGRPVRGSEECQDYCNPYHAGLALSDdGLLGTRPVMRPRGIDLKDGPLFDALCAKVQGKNVGIPVCEGAATSK 182
                            89*************************************87699******************************************** PP

                    VOZ  88 spwnaaelfdlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyein 175
                            spwna elfdlsllege++rewlffd+prrafesgnrkqrslpdy+grgwhesrkqvmk+fgglk+syymdpqpss++ewhl+eyein
  Traes_1DL_AEBCCB52B.1 183 SPWNAHELFDLSLLEGESLREWLFFDRPRRAFESGNRKQRSLPDYNGRGWHESRKQVMKDFGGLKKSYYMDPQPSSNYEWHLFEYEIN 270
                            **************************************************************************************** PP

                    VOZ 176 eldalalyrlelklvdekksakgkvskdsladlqkklgrlta 217
                            ++++lalyrle+k +d k+s+k+k+ ++sl+++q+++++l+a
  Traes_1DL_AEBCCB52B.1 271 DSNTLALYRLEFKASDPKRSVKSKLGSSSLNEIQQQMVKLSA 312
                            ****************************************87 PP

Sequence ? help Back to Top
Protein Sequence    Length: 428 aa     Download sequence    Send to blast
MGHGMQGEVA DVANALFSDQ MYYIDHELSI DDFLHGSNPD GLNNLQGTGQ PEHQQFNLPL  60
DLQHSNNSYA DANNSVQSTG DVFFHMSDLL TTVGPSPSQY LGPKCALWDC GRPVRGSEEC  120
QDYCNPYHAG LALSDDGLLG TRPVMRPRGI DLKDGPLFDA LCAKVQGKNV GIPVCEGAAT  180
SKSPWNAHEL FDLSLLEGES LREWLFFDRP RRAFESGNRK QRSLPDYNGR GWHESRKQVM  240
KDFGGLKKSY YMDPQPSSNY EWHLFEYEIN DSNTLALYRL EFKASDPKRS VKSKLGSSSL  300
NEIQQQMVKL SANSPVDNKR GARSKTKASQ KDTNANTYPA LKTTNQAGAS NAYEAVPLNI  360
PNQASAPNAY QTVAPSIPNQ DSTSNAYEDA SQVDPMSYLN ENVVYGPHLP YGYPDGKGDF  420
YWNPSGGA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3762940.0AK376294.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3120B09.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003568104.10.0PREDICTED: transcription factor VOZ1-like
SwissprotQ9SGQ01e-110VOZ1_ARATH; Transcription factor VOZ1
TrEMBLM8BF340.0M8BF34_AEGTA; Uncharacterized protein
STRINGMLOC_11494.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23433888
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.21e-107vascular plant one zinc finger protein